PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G348100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MIKC_MADS
Protein Properties Length: 268aa    MW: 30172.9 Da    PI: 9.5508
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G348100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.52.8e-314393151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyeys+
  Brast01G348100.1.p 43 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSN 93
                        79***********************************************95 PP

2K-box92.38.2e-311112084100
               K-box   4 ssgks.leeakaeslqqelakLkkeienLq.reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                         s++   ++e +a+++qqe++kL+++i++Lq ++ R l+ +++++++l++L+qLe++Lek++ kiR++Knell++++e++qk+e el+++n+
  Brast01G348100.1.p 111 SNS-GtVAEVNAQHYQQESSKLRQQISSLQnSNSRSLVKDSVSTMTLRDLKQLESRLEKGIAKIRARKNELLYAEVEYMQKREMELHNDNM 200
                         233.25999*********************9899********************************************************* PP

               K-box  93 aLrkklee 100
                         +Lr+k++e
  Brast01G348100.1.p 201 YLRTKVAE 208
                         *****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.7113595IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-413594IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-3236107IPR002100Transcription factor, MADS-box
CDDcd002658.25E-4536109No hitNo description
PRINTSPR004042.1E-323757IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003791IPR002100Transcription factor, MADS-box
PfamPF003191.2E-264491IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-325772IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-327293IPR002100Transcription factor, MADS-box
PfamPF014868.5E-22120206IPR002487Transcription factor, K-box
PROSITE profilePS5129713.78121212IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MMNMMGDLSC GGASSGKDQP GGTASAGEAA GSEKMGRGRI EIKRIENTTN RQVTFCKRRN  60
GLLKKAYELS VLCDAEVALV VFSSRGRLYE YSNNSVKATI ERYKKANSDT SNSGTVAEVN  120
AQHYQQESSK LRQQISSLQN SNSRSLVKDS VSTMTLRDLK QLESRLEKGI AKIRARKNEL  180
LYAEVEYMQK REMELHNDNM YLRTKVAENE RGQQPMNMMA AASTSSEYDH MVQYDSRNFL  240
QVNLMQQQQY SHQLQPTALQ LGQQHFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-2035103169Myocyte-specific enhancer factor 2B
1tqe_Q3e-2035103169Myocyte-specific enhancer factor 2B
1tqe_R3e-2035103169Myocyte-specific enhancer factor 2B
1tqe_S3e-2035103169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4693090.0KF469309.1 Brachypodium distachyon MADS-box transcription factor 14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289811.11e-172MADS-box transcription factor 3
RefseqXP_010230592.11e-172PREDICTED: MADS-box transcription factor 3 isoform X1
RefseqXP_010230591.11e-172PREDICTED: MADS-box transcription factor 3 isoform X1
SwissprotQ407041e-150MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLI1HD301e-172I1HD30_BRADI; MADS-box transcription factor 14
STRINGBRADI2G06330.11e-172(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-101MIKC_MADS family protein